SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085HJ00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085HJ00
Domain Number 1 Region: 454-556
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085HJ00
Sequence length 558
Comment (tr|A0A085HJ00|A0A085HJ00_9GAMM) Putative sulfate permease {ECO:0000313|EMBL:KFC95945.1} KW=Complete proteome; Reference proteome OX=1005999 OS=Leminorella grimontii ATCC 33999 = DSM 5078. GN=GLGR_1119 OC=Budviciaceae; Leminorella.
Sequence
MNGVRPFSALIDACWRDPYTIQRFFKDIIAGITVGIIAIPLAMALAIASGVPPQYGLYTS
AVAGIIIAVTGGSRYSVSGPTAAFVVILYPVSQQFGLSGLLIATLMSGVFLIIMGLARVG
RLIEYIPISVTLGFTSGIGITIATMQIKDFFGLTVDVPEHYVDKVIALASALPTISWADT
LIASVTLAVLILWPRLGLRVPGHLPALLAGTAVMAILSWAGYSVATIGSKFHYLMPDGSS
GQGIPPILPQFVLPWNFPDASGQPFVLNWSTISALLPAAFSMAMLGAIESLLCAVVLDGM
TGRKHHSNSELLGQGLGNIAAPFFGGITATAAIARSAANVRAGATSPISAVVHSVLVILA
LLVLAPALSYLPLAAMSSLLLLVAWNMSEAHKVVDILRRAPKDDIIVMLLCMSLTVLFDM
VIAITVGIVLASLLFMRRIARMTRLTEIKGGSDDSCIAMRVSGPLFFAAAERIFNELTQR
LDGQKTIVLQWDAVPVLDAGGLNALQRFIDVLPEGVELINCDIQYQPLKTLARAKIKPVD
GRLSFYSSLDEALAAAKR
Download sequence
Identical sequences A0A085HJ00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]