SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085ILU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085ILU9
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085ILU9
Sequence length 96
Comment (tr|A0A085ILU9|A0A085ILU9_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:KFD09195.1} KW=Complete proteome; Reference proteome OX=1006000 OS=Kluyvera ascorbata ATCC 33433. GN=GKAS_00071 OC=Enterobacteriaceae; Kluyvera.
Sequence
MAEQLSWKRDGERLALHGELDQDFLVSLWDARTEATQGVSIIDLSGLSRVDTAGLALLVH
LVELIRAQGRTPSLEGVSEKVATLKSLYNLPEGMIP
Download sequence
Identical sequences A0A085ILU9
WP_035891143.1.87751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]