SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085JC50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085JC50
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 2.35e-16
Family H-NS histone-like proteins 0.0004
Further Details:      
 
Domain Number 2 Region: 90-132
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000051
Family H-NS histone-like proteins 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085JC50
Sequence length 132
Comment (tr|A0A085JC50|A0A085JC50_9GAMM) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome; Reference proteome OX=1005995 OS=Tatumella ptyseos ATCC 33301. GN=GTPT_2778 OC=Erwiniaceae; Tatumella.
Sequence
MSDAFKVLNNIRTLRAQARDLALSDLEEVLEKLTVVVNERREEIEAEQALNREKEEKLTK
YREMLLADGIDPNELIGAADVSKKRVKRAPRPAKYKYTDENGETKSWTGQGRTPAAIKKA
LDEGKSLDDFLI
Download sequence
Identical sequences A0A085JC50
WP_025902894.1.77428 WP_025902894.1.88295 WP_025902894.1.95709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]