SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085JP17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085JP17
Domain Number 1 Region: 13-107
Classification Level Classification E-value
Superfamily DsrEFH-like 5.59e-29
Family DsrH-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085JP17
Sequence length 107
Comment (tr|A0A085JP17|A0A085JP17_9GAMM) tRNA 2-thiouridine synthesizing protein B {ECO:0000256|HAMAP-Rule:MF_01564} KW=Complete proteome; Reference proteome OX=1005995 OS=Tatumella ptyseos ATCC 33301. GN=GTPT_0386 OC=Erwiniaceae; Tatumella.
Sequence
MTESSPSEIKRLMLHTLMHSPWQSDIAGRISLLSEDDDVLLLQDGVLAALEGNPFAKMLL
QSPATIYVLEEDLLARGLTEQISANMCKVGYNGFVELTIRHPQQLVW
Download sequence
Identical sequences A0A085JP17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]