SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085K2R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085K2R3
Domain Number 1 Region: 17-201
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.53e-39
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 190-294
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 3.79e-36
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085K2R3
Sequence length 302
Comment (tr|A0A085K2R3|A0A085K2R3_SPHYA) UDP-N-acetylmuramate dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00037} KW=Complete proteome OX=13690 OS=Sphingobium yanoikuyae (Sphingomonas yanoikuyae). GN=CP98_00794 OC=Sphingomonadaceae; Sphingobium.
Sequence
MASLPAVRGALKADAPLAPLVWFKAGGAAQWLFEPKDADDLSDFLAMLDPAMPVMALGLG
SNLIVRDGGVPGVVVRLGKPFAKVEALDATTLVCGGGASGILVSSTARDAGIAGLEFLRS
IPGTVGGFVRMNGGAYGRETADILVECEVVLRSGEQVTLLNRDLHYSYRHSNMVDGAVVV
SATFRGEPGEPAAIQAEMDRIATAREESQPLRSKTGGSTFKNPDGHKAWALVDEAGCRGL
ALGGAQVSEKHTNFLLNTGDATSADIEALGEEVRRRVKEKSGVELEWEIQRVGVQLIEGK
NA
Download sequence
Identical sequences A0A085K2R3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]