SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085LRI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085LRI9
Domain Number 1 Region: 293-469
Classification Level Classification E-value
Superfamily MIR domain 5.62e-34
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1158-1285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-23
Family SPRY domain 0.052
Further Details:      
 
Domain Number 3 Region: 4260-4321
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000067
Family Calmodulin-like 0.069
Further Details:      
 
Domain Number 4 Region: 741-875
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000704
Family SPRY domain 0.049
Further Details:      
 
Domain Number 5 Region: 175-256
Classification Level Classification E-value
Superfamily MIR domain 0.000000392
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085LRI9
Sequence length 5145
Comment (tr|A0A085LRI9|A0A085LRI9_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD47585.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_11549 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MEQFENAAFVLQVERADLKHWVKLLTALSAAVTSEQAMKLPQRLACPKLAVEMKHTSDHR
WFDELSPFDHYFREAISKLQWLIFKKTVLGDVVCLTCIAPSKETGTGSVERVALAAEGFG
NRLCYLENVSDRNVPPDHATSMFYIHKALSVRALREMMSCDTPGTAGSSSSHRTLLYGHA
VQLRHVLSTMYLTCLSTSSATDKLAFDVGLCEADSSESCWWTIHPASKQRSEGEKVRVGD
DIILVSVATERYLHMSCSKGIMTVIAAFHQTLWSVTPNSSGSVRNRNLGYVFGNDVLRLY
HGNDECLTIPETWSDHSQQNIVIYEGGKSCSQARSLWRPELLHGKWQGSLIGWEQVFRIR
HVTSGRFLAVTADGQVSLVHKDKATFESTAFITVSSKDVKRTSFEEKEEEGMGVAALKYG
ETVTFLQHLQTGLWLSCQTTAVTKKNVGKVEEKKAVAVEEARMDDCFVLFKAQGEEAQSA
RVIRKSSQILNRFLKGLEGLQFEGRDSQQWRRANLLETVKLMEDLIEYFAQPKEEDFDFE
TMQNRLRALRNRQDLFQEEGVLNMIIDTIDQLSSVESTGEFSEVMKETGSREWEQISTYL
YLLVAAMIKGNHSNCTQFASAQRLDWLFNRLSNPQAAEGILDVLYCILTESPEALNLINE
THVKSVISLLEKVGRDPKVLDVLSALCEGNGVAVRSSQNIICNELVCNKNFLLQTRMVDQ
VSSVMANIFVSVTEGCAIFKRWYFEAELEYMDSMSSSYPRPHLRVGWASSAGYVAYPGSG
KKWGCNGVGDDMFSFGFDGKNMYAGGVKKTVGSRDLSRGDVIGCCIDLSIPEIRFSLNGS
EVNTSFRGFSVADCLFYPVMSLSATVSCRLILGEPHGKLRYGPPEGYLCVTEAAVTPIKI
QPCIVYGDYRKGYFYGPSTVISDFALFQPKPVDSREIILPKHLEEACDRLAENIHELWSM
DKIEKGWKYGERRSESQRIHPCLTNYERLPNAERAYNMNLARETLKTILALSYRIDPGKL
PNRVKTLRLPQNFLMSNGYKPSPLDTREISLSESLSNLVEQLAKNLHNIWAQSKVQRGWT
YSSVENSAFKTSPHLVSYEYLNPTIRAANREKAGQIVKSLMVYGYTLEAPAMEIDEATTK
QTEVLQMKLRTYRMERRYAVTSGKWYFEFEVRTPGFMSVGWMDVDSPPDADLGTGKLSFG
YDGYLGKKWHGEIEKFGKKWNVGDVVGCFLDLTDRIICFSLNGELLLDASGAEMAFDNVN
STGGLVPAFSLGPGQMCRVNFGQNVDSLKFYTTCGLQEGYEPFCIRMTRPAPLWISKFQP
EFEEIGDDDRRFKVLRVVQSGDNPPCLKIQCKPTGLQERSSLTLFRLNLPVRCEHRSTKS
TSASGQASRSTLRDSNRDDATETTSADTSRRSKPSVTERRRIEVSFVNGDSATTPSEKQQ
DNVDPESTRRGSGFLTKTLSLDEDSSVVQRDTLKPTVLRSSASEVNLKDRDHRSDAQNSK
MSESMSSTSSKRSRKPFKVLQSFGQRMRDASIGRAKKHSTPKNANTQNARSRDVSSEGSN
HFVSNREGVLAVDSSESLDMPKTGPGRRPTLIRVDSEKSKQRWNRYLSRGHEFLAEEMNL
ARQSIVQSLNSSLLPSSLAETYTEYYFGLRIYPGQDLANIWIGWLTPQFSYSINNHLTSA
FAQKVIFKERDSGATVNDQEFRSCYVVNALDLLAAVSGGSNVSKISGLLAGCIVNTATGE
LTFHANGRQTEMCFRVETGTLLYPTVFVIPTGKEVLQFELGRVEKTLPIASAQFNEMSNG
MQLQCPPRLRIEICKSRNWSLVPQRCPRVTSLKLSDTRGWSILCDDVARLMMLYIPERDY
SLDILELIEYADLQKFHQHTLQLYCSLCAHGNFKIAHILCRHVDEDQLTYAMKSKYITGQ
LRQGFCDLLVAMHLSCHYNARMQSNKEYIIPLTEKLKSRNYFSIDCKGIYPHAVNSTVSM
KPAMDVMSVKDNITTKEEMFLRSPGFDFEALKSFVIDSLEEATVQALMHSRDLVGGTNTS
HFAPLLKLFDTLLLVGLFTDEDIQRLFRILNPSVFDDQQSSNMVHRNGLLSLELDEEVQR
HVCYVLSHLCDLLLQGRVETMISFAESFVGETQNDQLQRYMYIKQTDMPPAEAARRTKEF
RCPPKEQMLKLLNFKSSDCNMLDEEGEVEISSMSEYLQNVLRSFHEGMIRCIGNKPVDDS
APFSVDDIYAGDKPIDWVDKLALLVVPVPPDNGSGSTSLIPDGEEAFRKLIISTLIDWTS
KKHIDDAVLIREIFSLLLRQYTRIDELMKALRTTYCIHERSIDDVQRFINHLSQIRRLLS
VQFEAVDEEVLKDSLWQMMNNKVFFQHPDLMRLLKVHENVMTIMVNVLSRAQQGDAANRR
TKDEATTNGNDFKNSISDLVVACCKFLCFICRSSTANQAAMFEHLPFLLDNATMLLAKPS
LRGSVPLDVAYYSFMDNSELALALKEDELEKVAFYLSRCGLQANAAMVAKGYPDIGWDPV
EGERYVDFLRFCVWVNGECVEENANLVIRLLIRRPECLGPALKGQGEGLLRAFKDAISLS
TEIHNFNSGRNVRNRFMFDITNYPNPADENEDYIDMGAAILGFYSSLVDLLGKCAPDPLT
IKSGKSESLRLRSILRSLTSMDDLEGILALRFLLPNVFASNEESLKAPCYGLLPLHKSST
LLFLERVYGLVDREMMFRLLEQSFIHDFRAATILDHPSVAESDLALALNRYLCGAVLPLL
TNHAHFFAEADHYSSLMDATLHTTYRMSKIRSLTNNQRSAVTDFLLALTREISPSMMSRL
QQKVVKDISSLNEYAIVPLQIMTQHYEHFSRHYGSSTIEDVANEEQKRLSMLLFTTIFDS
MGKRAFDQELFARALPCLAAIASALSPDYAASSPDRDELHTPSAEDTDRETVWKPVPVDV
SHVQLSPGLQNLVLLFAQHFHDSWASRKLEKGWKYGETYSRVNLTHPRLRPFGMLKEFEQ
NFYKERCAECMKAMLAMGYVIEEENPVPPTKPATQQITPRGSVIFSPQPVDLSNMSLSEE
LSELAERVAQNSHLLWVAKAIDDLNVSNSGIIVQLVPWDILTDTERRKHRFRAQEILKFL
QYSGCRIKSPLPSSGSQGQQSLLTQSGHRSAKTRFAYSLMEKMLLYIESAALKMEVVKGS
KRFSRGSSCTLASEDVKFFSKVLLPLLEAYFRSHRNYFIATGSGVGIASMMEKEIVVNLF
HRLMSSLRRKLVAFGCNIRTTVRCLQVLISAIDFKSLVKTNSDSLRTCTQVLFTYVVGDL
TNIVKSIRKQGRYAEIRGKTLPCTSGLVYLNEVILPVLSTLFNHLAQQGHGPEFLVNDIQ
LSSYKIADSLYALSSLESPTRKSIKLELERHRSFIGQCLSAFACCFPVAFLEPEFNEVNK
FSILTHLDQTSQSKELLSSITADIPSLDKVLTDIEHLSQSGGKYQDAPAIFDVHVPTLCS
YFSSWWQHGPNGTPADKPITSVSSELVNRLFFACAKLICDHIGVQNANWVCHVAPFIQPM
ISYVTAEPVKDCLLPMTEKIKEKANEAFKEEERQRTHPEVVDEALHSVLVRDIYAVFPLI
IKFTDLHRARWLKNPSWETNSLYENVAFIFKIWSVSQNMKREELNFITQLDADTFMGGSD
LKTGKAAIAIRKKKRREGKKREKETNSIVVACLKRLLPVGLNVFGGRELELLQKIKEKHL
KREPEERIKEFIRSSLSVPDKEDIFDKSYWQRQLYHKIGKAQMLGISSMNQEAVLEAITS
MGLTLYNLHTVEHPQTDLAGAWRKILSSQRKRAVVACFRMVALHSIPRHRCINIFLPAYA
EKWMEDENMDRDLLICDLADFVEKGANVKRTKDEAEEEDLQMPDSLSQLIQCFQRAATAE
RKQLVTIERDELYKEFVRVMAISIHIGEEEEDGNADEAVNMEAQELEKQELRHQQARLAD
RGAAVMVLMYLSACHGEPNDMVDGTLKLGIHILNGGNSMVQDMMLAYLQDKKDVSFFSSI
AGLMNRGSVLNLEIFERQIKAEGLGMGAELSLGDHQNLNDAEFICTLFRFIQLTCEGHNS
EFQNYLRNQPGNTTSVNLIICTVDYLLRLQESIMDFYWHYFSKELVDEAGKANFLRALSV
CSQVFNTLTESVQGPCVGNQMALANSRLWDAINGFFFLFANMMDKLSKNHTQLELLREFL
SLQKDMIVLMLSMLEGNVLNGSIGKQMVDTLAESQQNVQLILKFFDMFLKLKDLTTSQAF
QEFDLNKDGWISPKEFQRAMEGQKMYSIEEINYLMMCTDVNNDGKIDYMEFTERFHNPAK
DIGFNLAVLLTNLKEHIVGDNRLDVILQTASSMCDYFDPFLGRIEIMGSNKRVEKVYFEI
KEEWLEQFNKPQIKQSKKDFLFNVLQDDGGQQGKLEAFVNFCEDTIFEMSHAAEISSEDK
DSRVERAKRQREIFTGQTERHDTISPYDIISLVFQKLFFFIHLCYKSCRPSQLVKAKNQL
RDSIASMTYGQLFLSVCRISFKLIFMVAWLTYLILSTLLRFIYFMMGGSKEDDYVALKSL
PEPPTSRSLNRQRSFISLLPDIEKSDVHKYEAFGLQLSQGTTEVEAANLVTDHEASKASF
SFYIGGSFPAKSKLGSPTDDAQQAYSDAHFGSESQKSFEQDDKVRFQATAYEPKIADVTP
KSRGSIFNVLARNFYVLKYITLALAFLINAILLFYRVSVNTAEISDSFAAPPESGNATTS
EVEVEEELSIHENYYYLTHVLKCLSVGHCLVSLALLIAYYQLKVPLIIFKREKQVARKLE
FEGMWITEMPSEDAVSGKWDSMVISSAKFPEKYWDKFVKRKVVEKYQDQFDIEELHRLLG
LDKQALENAGNSGSRSVDWRYQMWKIGVIFADGSFQYLMMYLFFSAVGIWNPFFYAGHLI
DVVFSFPMLQTILKSVTHNGKQLILTVMMVVVVVYMYTVLAFNFFRKFYVQDEDGQETDS
KCNNMITCFVFNIYAGIRAGGGIGDELQSPYGDEKEAWRILFDVTFYFFIIIILLAIMQG
LIIDAFGDLRDQQESAQDKLESNCFICDIGKDFFERLPHGFEHHTAKEHNLAYYLFFLMH
LINKDETEYTGQESYVWELYEKRCWDFFPVGECFLKQYEDQLMMA
Download sequence
Identical sequences A0A085LRI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]