SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085MG69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085MG69
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000259
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085MG69
Sequence length 124
Comment (tr|A0A085MG69|A0A085MG69_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD56215.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_02993 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MKTLSLLLFILLAANIAHGRSHAKSRKRESKNADSAPVGDVCSLPVEGGLCKEASGKWYF
DSEKAVCVMLIFGGCEEGGFDSEKDCQKRCANGAKAKARKPVQQSKDRRPNEPVIAGITW
TVLG
Download sequence
Identical sequences A0A085MG69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]