SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085SE77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085SE77
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085SE77
Sequence length 89
Comment (tr|A0A085SE77|A0A085SE77_VIBCL) Sulfate transporter {ECO:0000313|EMBL:AKO77255.1} KW=Complete proteome OX=666 OS=Vibrio cholerae. GN=EN12_18970 OC=Vibrionaceae; Vibrio.
Sequence
MLILNEVLDIAHVQECKQQLLPWMSQEAPIVIDGSAVARVDAAGVQLLASLFITAQHNGQ
QIHFEQLSDVLAEGLALLGMADLMQLKSE
Download sequence
Identical sequences A0A085SE77 A0A0H3ZWY2 A0A0K9UVR5
gi|379744473|ref|YP_005335525.1| gi|360037991|ref|YP_004939753.1| gi|384423346|ref|YP_005632705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]