SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085V9U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085V9U1
Domain Number 1 Region: 158-256
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.46e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085V9U1
Sequence length 283
Comment (tr|A0A085V9U1|A0A085V9U1_PSESX) Polyvinylalcohol dehydrogenase {ECO:0000313|EMBL:KFE52204.1} KW=Complete proteome OX=317 OS=Pseudomonas syringae. GN=IV02_09435 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAALQQRTVDALKKSQSGLTAKWLSSLEASGATRNIKEEDLKLQADDFLRLVISVAEKGS
HQSLGGSDWDEIRLFLEKLSHSRALSGQDSQQTASFIFSLKGPLFAMLQSEYEDSPTLLA
EQVLEISELLDALGMHTIRTFQKSREAVIKRQQEELLELSTPVVKLWDGVLALPMIGTLD
SQRTQVVMESLLQRIVDTGSEIAIIDITGVPTVDTLVAQHLLKTVTAIRLMGADCIISGV
RPQIAQTIVHLGLDLQGVVTKANLADALALALRRLGLTVTKAV
Download sequence
Identical sequences A0A085V9U1 S6GZF0
WP_020292606.1.32710 WP_020292606.1.74794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]