SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085VQ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085VQ74
Domain Number 1 Region: 18-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.85e-55
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085VQ74
Sequence length 205
Comment (tr|A0A085VQ74|A0A085VQ74_PSESX) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=317 OS=Pseudomonas syringae. GN=IV01_03255 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKTSFDVTRLDEHALPVVDAIVVGASAGGVEALLKVFAAIKVGFRLPIITVLHIPDERRS
QLASVFQARLQIPVKEADDKEDIVPGTLYFAGPGYHLSVERDFSLSLSQEDRVFHSRPSI
DILFESAADAYRERLVGVLLTGANNDGAFGLSLIKRAGGMTVVQDPAQAQARTMPEAALA
LHEPDYLLPLNDIGQLLVELERIAC
Download sequence
Identical sequences A0A085VQ74
WP_032625974.1.19806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]