SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A085ZIS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085ZIS4
Domain Number 1 Region: 11-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.68e-46
Family Methylesterase CheB, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085ZIS4
Sequence length 197
Comment (tr|A0A085ZIS4|A0A085ZIS4_9FLAO) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=362418 OS=Flavobacterium reichenbachii. GN=IW19_01810 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MEENKIITGCKVIIIGGSAGSLYALIQILPEIVKVNSFAIVIVVHRKSSDEQTLEDLLTL
KSKLEVKPVEDKVPLLPNYIYIAPSNYHLLFEKEETLSLDTSEKINYSRPSIDVSFESAA
EVYGSSLIGILLSGSNKDGTLGLQAIQAAGGTVVVQNPLSAEMPFMPNNAILNMTPDFIL
NVQEILEFILSVNSTEI
Download sequence
Identical sequences A0A085ZIS4
WP_035680462.1.23404 WP_035680462.1.82313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]