SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085ZW57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085ZW57
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.54e-29
Family Ribosomal L11/L12e N-terminal domain 0.000093
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.22e-24
Family Ribosomal protein L11, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085ZW57
Sequence length 148
Comment (tr|A0A085ZW57|A0A085ZW57_9FLAO) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736} KW=Complete proteome OX=421531 OS=Chryseobacterium luteum. GN=IX38_04310 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MAKKVFKMVKLQVKGGAANPSPPVGPALGSAGVNIMEFCKQFNGRTQDKPGQVLPVVITV
YEDKSFEFVIKTPPAAIQLMDAAKIKGGSGEPNRNKVGSVSWDQVKKIAEDKMTDLNCFT
MDSAVSMVAGTARSMGLRVTGTKPTFNA
Download sequence
Identical sequences A0A085ZW57 A0A0J7I9Z1 A0A1G8DGC9 A0A1M4ULX6 A0A1M5VPE4
WP_034702033.1.19323 WP_034702033.1.20732 WP_034702033.1.25497 WP_034702033.1.44062 WP_034702033.1.59939 WP_034702033.1.63415 WP_034702033.1.66116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]