SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086BL77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086BL77
Domain Number 1 Region: 407-492
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086BL77
Sequence length 512
Comment (tr|A0A086BL77|A0A086BL77_9FLAO) Sulfate permease {ECO:0000313|EMBL:KFF29691.1} KW=Complete proteome; Reference proteome OX=558152 OS=Chryseobacterium piperi. GN=IQ37_04580 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MDTYTNIFSFSKKINYKNELLAGFTVAMTMIPESLSFAILAGLSPLTGLYAAFLMGLITA
VFGGRPGMVSGGAGATVVVLIALAKSHGVEYLFAAVALAGIFQILVGVFKLGKFVRLIPQ
PVMYGFLNGLAVIIFMAQVEQFKMTDSNGVVSWLQGASLYNMAGLTALTIGIVYFFPKIT
KAVPASLIAIIIVFALVFGLGIHTKTVGDIGHISGNLPQFHIPKVPFSLETLNIIFPYAL
IMSGVGLIESLLTLSMVDEITNSKGNANRESIAQGIANMTNGFFGGMGGCAMVAQTLVNL
NAGSRARLSGIIASITILGIILFGAPFIEKIPMAALVGVMMMVAISTFQWVSIRIVNKMP
KSDIFVGITVALITIVLHNLALAVLVGVVISALVFAWDNAKRIRAIKYIDDNGVKYYEIF
GPLFFGSVTAFADKFDPANDPDKVIVDFKESRVVDMSAVDALDKLSKRYHQYNKTLHLRH
LSEDCRKILKNAEAVIDVSIQDDPTYKVMPER
Download sequence
Identical sequences A0A086BL77
WP_034682202.1.69742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]