SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086GE43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086GE43
Domain Number 1 Region: 444-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086GE43
Sequence length 567
Comment (tr|A0A086GE43|A0A086GE43_9GAMM) Sulfate permease {ECO:0000313|EMBL:KFF89457.1} KW=Complete proteome OX=1449981 OS=Serratia nematodiphila DZ0503SBS1. GN=JL05_15565 OC=Yersiniaceae; Serratia.
Sequence
MQWKPLQALTPGLTHLLGYQRSWLKPDIRAGLSVAAVALPVAIAYAELAGVSPVVGLYSC
VLPMVAYALFGSSRQLIVGPDAATCAVIAAVVTPLAAGNMERHWQLTIMMTAMMGGWCLL
ASRFKLGALADLLSRPILSGLLNGVAITIIVDQIGKVLGFTMRPAQLIERIYALPGNLLH
SDWLTMAVSSLTLVTLLGFKKWRPNWPAPLFAIVLAAFVTWAGGLQQHGVVTVGGFSGVL
PIVQWPDFQPGLLRDMVIPALNLAVVSFVSMMLTARSFAAKNGYEVNADAEFRALGLVNI
VSALSQGFAISGADSRTAVNDANGGKSQLVSIIAAAVIAFVLLFLMAPLQFIPVAGLGVV
LMYAAWSLLDIRGIWILRRRNAQAFRLALFTFLSVLLVGVISGIGLAVLLGLMQFLRTVF
RPTEQLLGVNDEGMIHSMGNNNGVKAVPGVMMYRFNSPLTYFNVAYFKRRILNLVDGTPF
QPRWVVVDAVASFTHADISVLAAIDELKRDLLQRNVRLVLAGRRTELTRWFRINRLGRDK
ELILVPDLYLALKLIQSKEQAEAAVVG
Download sequence
Identical sequences A0A086GE43 A0A0P0QF77
WP_033632891.1.25326 WP_033632891.1.26989 WP_033632891.1.58287 WP_033632891.1.70753 WP_033632891.1.78348 WP_033632891.1.81556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]