SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086GSN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086GSN2
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.96e-18
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086GSN2
Sequence length 156
Comment (tr|A0A086GSN2|A0A086GSN2_STRSC) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=1930 OS=Streptomyces scabiei. GN=IQ62_24475 OC=Streptomyces.
Sequence
MTPDAHDRAAPRPEDVATGPGPGPAAAAAAAAAANPYARTRRIGPFTVIEVSGEIDVASA
GLVAEHLTAATTGSAEPDVLVDLRHVSFFDCSGLRVLCRAEAAAAAHGGRLRLVSDQPRM
YRLLRAARLLGRFPPLPDLPPVPPPSPPPPQRPSLK
Download sequence
Identical sequences A0A086GSN2
WP_037698528.1.88324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]