SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086JEG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086JEG0
Domain Number 1 Region: 32-169,221-294,351-419
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.84e-55
Family Capz alpha-1 subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086JEG0
Sequence length 424
Comment (tr|A0A086JEG0|A0A086JEG0_TOXGO) Putative capping alpha-like subunit {ECO:0000313|EMBL:KFG30528.1} KW=Complete proteome OX=943119 OS=Toxoplasma gondii p89. GN=TGP89_208390 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MEDAANGDSQLSAGVDAPRSNVEEDSGDAETLAKTRCIVRFFANNSPPDQLKSVVEDCEM
LAADGNLMDYDFLEGVLETAHDETLALFAFAPGEGQPVVQGIMCREGKLGDNVYLYPPAK
LTVTISHSTCALLLPPRPASPSCFPEELEPYRQALEDTFSCYVGLRYSDDSVEPRRSAVR
TRHASAVYSRVLSENEKETTEASDASSSGESDTYVPPQSSSAVAFVKEGGGKVYKLTAAM
SLRHSNAESCWAAARTSYWEVYFSVATQRLVIEGEVRLRSHTCEDWNAQVDYRRRFVSRE
AAARKGETVGTDNSEEREQKNGNDTPQTAEHLPPEARAKGVSEKHGKRVADWQEGLYVEN
CRDVEDPTALARHVIEFIKTKETEVLSDEKHYFHVYVPDTLRSLRRVLSLTGRSFDWQQQ
SLQL
Download sequence
Identical sequences A0A086JEG0 A0A086LVD1 A0A125YZ17 A0A2G8XUW4 Q1JSR5
gb|TGGT1_021400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]