SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086JL78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086JL78
Domain Number 1 Region: 107-251
Classification Level Classification E-value
Superfamily MIR domain 0.000000017
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086JL78
Sequence length 296
Comment (tr|A0A086JL78|A0A086JL78_TOXGO) EF hand family protein {ECO:0000313|EMBL:KFG32896.1} KW=Complete proteome OX=943119 OS=Toxoplasma gondii p89. GN=TGP89_266105 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MLTEGRSEPVPEPDLSCRIHSVCFTPSNAENPGELSVLKKIKRLSASLQPATLSKSEDGY
LHFGQRVMIVNERTGGFLCADVGDKTEKTTGVSFACATGPSYDSCVRNVFHLCRPINDDS
FGSDTVIHFGQPVTVKVDASLSQLCPVKHGNQDRYLHSEIRSPISFAKFSNYQQVLFCPT
TSANTVWKIFHVDPRVRFETEGCPVPANTPIVIKHAQTDQMLASSPKVNYRNDYGVEYEV
HCKSYLATNKTQNLIAEACGRTTSDIDLRQQETENNWMIITADTHSESQASSTTES
Download sequence
Identical sequences A0A086JL78 A0A086LJY9 A0A086PMD5 A0A125YYT3 A0A139Y3E3 A0A151H5M4 S8GGU3
XP_018636285.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]