SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086JS92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086JS92
Domain Number 1 Region: 2-112,164-237,294-362
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.46e-45
Family Capz alpha-1 subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086JS92
Sequence length 367
Comment (tr|A0A086JS92|A0A086JS92_TOXGO) Putative capping alpha-like subunit {ECO:0000313|EMBL:KFG35010.1} KW=Complete proteome OX=1130820 OS=Toxoplasma gondii GAB2-2007-GAL-DOM2. GN=TGDOM2_208390B OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
CEMLAADGNLMDYDFLEGVLETAHDETLALFAFAPGEGQPVVQGIMCREGKLGDNVYLYP
PAKLTVTISHSTCALLLPPRPASPSCFPEELEPYRQALEDTFSCYVGLRYSDDSVEPRRS
AVRTRHASAVYSRVLSENEKETTEASDASSSGESDTYVPPQSSSAVAFVKEGGGKVYKLT
AAMSLRHSNAESCWAAARTSYWEVYFSVATQRLVIEGEVRLRSHTCEDWNAQVDYRRRFV
SREAAAGKGETVGTDNSEEREQKNGNDTPQTAEHLPPEARAKGVSEKHGKRVADWQEGLY
VENCRDVEDPTALARHVIEFIKTKETDVLSDEKHYFHVYVPDTLRSLRRVLSLTGRSFDW
QQQSLQL
Download sequence
Identical sequences A0A086JS92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]