SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086JVZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A086JVZ5
Domain Number - Region: 1158-1244
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000373
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086JVZ5
Sequence length 1279
Comment (tr|A0A086JVZ5|A0A086JVZ5_TOXGO) Inorganic anion transporter, sulfate permease (SulP) family protein {ECO:0000313|EMBL:KFG36313.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_280500 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MAAKLTGVPNCSEAESDNTSAAGFAGHLGASENTNETIVLQPEESNAQRPSAGVGVCQND
EPDRWQTAIGSPKPLLCSIAADTDGQETVCPGRKNVAEVPFTQPSFTKKTFSSGIWRKTV
LPSKESNNQKKAAQFQGSPISFRNAEAPSSVALSSCDGCPSAYVGRLAQPSSAYLFAGGA
TKQPDNSIAWLQTGDEQAVTHESGSTGSVPEMQTADFPQMPSNPGSQCGAESVVRRGDTT
QQESSAEARRALSIQFQGRDTGVRHVMRESPGGASRLSLTENRGISSNVDRRGIPSCLSD
TYNNRAELRQDCCSLFVERPYGGGDPPQSFFIYGHRLFSNTPSTSECISTVSHHNVGKNF
LPSSSCSYSAPCNTNGCSYSKRENEKAPSSHRNTEAGAGQQHRIWLRRIRGTPFSVCENC
GTPFDTRPQVDGRSVSHSGNCGRDPSRAGEDMHRQPTKGSNEQEHEHEKQPDSKRGISSP
LADLCSALGEGTDSQGLTPVQDRDTNTCSRESCTSTRSSADTLVEHIDGLAANTPSDTER
SGKRKRSVSEVGSRCDLSGTGASSFEEVRTTSAVSASNTNTCLLPLGERTSEAQKRPVSG
CCLINSRRPTVEKRGCLQSSYTCRRDRRKCPFHGSSARSDSDDDDDGSPPCRCYSLHRTE
SLFPTSKENSNDGGDSHRIAKDLGSNGEDGMCSCSSALESLKGVTWGWGFQSSPKASLNY
YFGELKSGLAVPMSQLPATMTCAIIANVPVAAALHGAWITGLITAVFGGSPLSVTTVTSS
LAVTLAKVTRTKCDEVTNVCHEEGLEFIFPALVLAGFCCFLLGLLRLSRFSQFVPSATIV
GYLNAVAILNVRAQVETFRFDPVTSTGYEWIWVLLMIIVVFGVMCCWEKIPHIMLNRFIP
SSVLAIALSSFIEFVFVRRIAHMQTKTVASLSSMTEGDIWPKPFFLTPENIKPLSFYLQP
SNLLTMLELTLALVMVNYISTLITVDMMSDKVGTMRSEPDQHLVSVGAANTVACFLGALP
GSTAPSPSLLNLKVGGKGRESSVFCALVNLALVAASTYLLDYVPLGGLAGIIMYTAYHAF
QWSAVAAMFASFLPARLRQKHSFLQRKICRSDAFVMLLTTIIAISADIGTAILSGVCISA
CVFAWKNGSRLSITSRVDPESGIKYYRVKGPIFFLTKRKLLRSFDIERDPPSVVFELTGD
ACQLFDFGAMETLDTIVARYRKKNKRVRVVGMQRGDKKMIVKAGRMFEFAQIDIVERAID
EGDGPNTIPPIADMMKLPC
Download sequence
Identical sequences A0A086JVZ5 A0A125YT01 A0A139Y0N2 A0A151H3X1 S7W9G2
gb|TGGT1_072810 gi|211969108|gb|EEB04304.1| gi|237844293|ref|XP_002371444.1| XP_002371444.1.89292 gb|TGME49_080500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]