SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086KD12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086KD12
Domain Number 1 Region: 82-142,175-264
Classification Level Classification E-value
Superfamily MIR domain 3.14e-17
Family MIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086KD12
Sequence length 328
Comment (tr|A0A086KD12|A0A086KD12_TOXGO) Putative transmembrane protein {ECO:0000313|EMBL:KFG42280.1} KW=Complete proteome OX=943119 OS=Toxoplasma gondii p89. GN=TGP89_228630 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MAHSRERRSPSCLVSPLSPPTASGQRDVSVSERREKTCNAPCVSPFSRMKTSASPSFLLS
NWCLIFLLFSLFCVIEGAKPKEGRPVTYGSAVSLVHVLSGFKLFSGKISWGSGSGQQAVT
ATPSGDKAAAANMLWIVSAPPSGMRRQPLDSPVMEAQMAGSKSSASSEPAPALVTPGAAG
EPVRCGSVIFLEHGSSRGTLQATGASSPISSQKEVSVGAGRDTRVAGFKLVCANTKSEMW
LTGDIVTFEHVRLGTNLQAKKDHQFTQQNCGRGCPIAGHIEVSVSNEKPRSSWGWSTPPD
QWKASAGLMVNKEGEGLFDDLGFDHDEL
Download sequence
Identical sequences A0A086KD12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]