SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086L2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086L2S8
Domain Number 1 Region: 13-64
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000011
Family Capz beta-1 subunit 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086L2S8
Sequence length 65
Comment (tr|A0A086L2S8|A0A086L2S8_TOXGO) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:KFG50946.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_219290A OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MFATGNSPVPAAMEESWIAAVSLTRRMPPKLIDRTVAGVQHLCPDLSIQLLTRVDRRLRL
CFDSE
Download sequence
Identical sequences A0A086K1R1 A0A086L2S8 A0A139Y9N7 A0A151HCV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]