SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086M7M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086M7M3
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-47
Family Capz beta-1 subunit 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086M7M3
Sequence length 264
Comment (tr|A0A086M7M3|A0A086M7M3_TOXGO) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:KFG64891.1} KW=Complete proteome OX=935652 OS=Toxoplasma gondii RUB. GN=TGRUB_219290 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
ARKFFIACIYNQHGSSFRSPWTNAYIEGNDVSVLGAVPQRRIKPADNLRNLETTYNRIFD
SYRRAYYEGGVSSVYLWSLPSEDGFAGAFLVRHALDGGVSGDGPRGCWESVHVVEVTQST
SNVHYRLTSTVMVDVDPPENAEANFYAGAMLTRTSEQSQKVTDLLTGPEVPPHIGVIGPM
IEAMEDRMRTAIERNYFAKAYSILDGMIRTRHNTKEPKKAAFFSELSSSLSLLSRGSGGG
PGSPGGRSMRGSRSFLRPRSGSDN
Download sequence
Identical sequences A0A086L2T1 A0A086M7M3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]