SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086MI82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086MI82
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086MI82
Sequence length 111
Comment (tr|A0A086MI82|A0A086MI82_9RHIZ) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1549810 OS=Microvirga sp. BSC39. GN=JH26_15695 OC=Methylobacteriaceae; Microvirga.
Sequence
MLSTDLRNNVLVVRVEEKRIDASRAPAFKDEMTRCIEAGQNQLVLDLSRVDFIDSSGLGA
LVSCLKRLGPRGSLAVAGATGAVSRLFTLTRMDRVFALHPDVDTAVEQLSA
Download sequence
Identical sequences A0A086MI82
WP_036352339.1.9847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]