SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086MSD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086MSD2
Domain Number 1 Region: 13-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086MSD2
Sequence length 128
Comment (tr|A0A086MSD2|A0A086MSD2_9ACTN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1915400 OS=Streptomyces luteus. GN=FM21_31935 OC=Streptomyces.
Sequence
MRQEPASPTRHLRVLHDRGHTVLEFLGEIDIASAAEIVPHLDRETGRPGALVVLDLGGIE
FFDCSGLRLLYRARHRVLDGGGEVHLVCAHPLTLRMLRITGLAEVLPPRPTLDEVFGISR
QAGRRTGH
Download sequence
Identical sequences A0A086MSD2
WP_043384381.1.42235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]