SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086MVX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086MVX9
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086MVX9
Sequence length 114
Comment (tr|A0A086MVX9|A0A086MVX9_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KFG73047.1} KW=Complete proteome; Reference proteome OX=1915400 OS=Streptomyces luteus. GN=FM21_19600 OC=Streptomyces.
Sequence
MTVDPRRSSPTTAPVRIAEADGHHAVLTFSGDLDAPALRVLEEILLDHRLREPTAWTLDM
TGLRHIDLACAYALLRAVTETPEREIAITVRGARPAVHRTLRHAGVDTVATFEH
Download sequence
Identical sequences A0A086MVX9
WP_043378422.1.42235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]