SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086PF08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086PF08
Domain Number 1 Region: 417-496
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000011
Family Anti-sigma factor antagonist SpoIIaa 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086PF08
Sequence length 498
Comment (tr|A0A086PF08|A0A086PF08_SPHHM) SulP family inorganic anion transporter {ECO:0000313|EMBL:KFG91976.1} KW=Complete proteome OX=1219045 OS=16415 / MH) (Sphingomonas herbicidovorans). GN=BV98_000227 OC=Sphingomonadaceae; Sphingobium.
Sequence
MLKALSGGTFSRDLTASIVVFLVAMPLCMGIAVASGVPPEKGLITGIIGGIVVGMLAGSP
LQVSGPAAGLAVIVFEIVREQGLSALGPILILAGAIQVVAGLMRVGGWFRAISPAVVHGM
LAGIGVLIVVGQFHVLFDDKPLSSGLANLMAMPGQIFGLSNQDAATAFAIGLVTIGGMLG
WEKFRPAALKLLPGALVGVVLATLVAFVLGLPVARVVVPESIVAAVSLPEQGLIQQLMNP
TILTTAIAIAFIASAETLLSAAAVDRMHDGVRTNYNRELSAQGVGNLLCGFAGALPMTGV
IVRSSANVQAGAKTRLSAILHGIWILGFVALLPWLLREIPMAALAGILVVTGVRLVSVDH
VKHLLHRYGPLPAVVWAATLIMVVTTDLLTGVLVGIGLSLLELLPHARRLGLRLDEDHRD
DAHEVALHGTATFLTLPKLSARLESVPAERSVILNVERLLHIDHTCAEMVREWIDRRRNT
GATVELSGATGRLRNLAA
Download sequence
Identical sequences A0A086PF08
WP_037461776.1.25636 WP_037461776.1.49475 WP_037461776.1.97289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]