SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086Q847 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086Q847
Domain Number 1 Region: 107-251
Classification Level Classification E-value
Superfamily MIR domain 0.0000000157
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086Q847
Sequence length 296
Comment (tr|A0A086Q847|A0A086Q847_TOXGO) EF hand family protein {ECO:0000313|EMBL:KFH08779.1} KW=Complete proteome OX=943118 OS=Toxoplasma gondii MAS. GN=TGMAS_266105 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MLTEGRSEPVPEPDLSCRIHSVCFTPSNAENPGELSVLKKIKRLSASLQPATLSKSEDGY
LHFGQRVMIVNERTGGFLCADVGDKTEKTTGVSFACATGPSYDSCVRNVFHLCRPINDDS
FGSDTVIHFGQPVTVKVDASLSQLCPVKHGNQDRYLHSEIRSPISLAKFSNYQQVLFCPT
TSANTVWKIFHVDPRVRFETEGCPVPANTPIVIKHAQTDQMLASSPKVNYRNDYGVEYEV
HCKSYLATNKTQNLIAEACGRTTSDIDLRQQETENNWMIITADTHSESQASSTTES
Download sequence
Identical sequences A0A086Q847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]