SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086STG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086STG0
Domain Number 1 Region: 653-781
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000863
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086STG0
Sequence length 795
Comment (tr|A0A086STG0|A0A086STG0_ACRC1) Putative sulfate transporter-like protein {ECO:0000313|EMBL:KFH40392.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_089450 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MADRPPFNRSTSGDYRPAHPSTLRQSRRASSILSPGSSDHPNETGNSPMSSSDRPAASPG
PEMMSRPDRPSASETTPLVASHLTSRSTGAHAGICTHGTFSPRPESPIDSTIPGSGSDGS
STPGSGTRIPIVDRAISHVVGHDDWKKALKGLMRTKKMDQSSELAEQAGIRDTWFMYLSY
YVPCLIWLRQYKLSFIRGDFVAAMTMASIYLPMALSYASNLAHVPPIHGLYAFVFNPFIY
AIFGSCSQMVVGPEAAGSLMIGSVIKGSVDSGEGTDDDGLLHSRICGIVTGMAGGMVLIA
GLFRLGFVDSVLSRPFLRGFISAIGFVIIVDQLIPELGLADMAAHKGVTHGSSVDKIRFL
INNADKTHKPTFILAGVCFVIIMVARDIKRRLQPRMPSIIFVPDRFLVVVISAILCWYYR
WDKMGVAVLGSVKTATGSLFVFRWPFRLSQMRYIRDGMSTSFVIALLGFFESSVAAKSIG
GKSSIQGMQLSANRELIALGFANVIGGSFLSLPAFGGYGKSKVNQQTGGKSPMSSVFLST
IALLSILFLLPYFYYLPKPVLSAMISAVACSLMEEAPADIGFFLRIRGWTELGLMALIFL
ATIFYSLALGMALGVGVSLLLVIRHSTRPRIQILGRDPETDKFENAEADFTRLEFIEGCL
IVKIPEPLTFANTGELKARLRRLEMYGSASAHPALPRLRSHDANRNVIFDIHGVTSIDGS
GTQVLTEIVKDYRDRGVRVFFTRGPSPGSRLPVWRLMKSSGIVDMCGGESHFVNDVEQAL
RMTDREESIMDGTVG
Download sequence
Identical sequences A0A086STG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]