SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086SWB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086SWB0
Domain Number 1 Region: 676-899
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.91e-66
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00076
Further Details:      
 
Domain Number 2 Region: 901-1062
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.42e-37
Family NADPH-cytochrome p450 reductase-like 0.0012
Further Details:      
 
Domain Number 3 Region: 416-661
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.48e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.001
Further Details:      
 
Domain Number 4 Region: 270-430
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.43e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086SWB0
Sequence length 1062
Comment (tr|A0A086SWB0|A0A086SWB0_ACRC1) Sulfite reductase [NADPH] flavoprotein component-like protein {ECO:0000313|EMBL:KFH41392.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_079060 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MSSPAHGTKPAGFQQSATSLPFGQPVPLSSISGPAYVTAQLLVQQIAYKLSDKIFSYSPE
TFDLDVALKDWAAKGEKNIHDYPTAVLPLQTRTGAGALALGYIFSPDFDIAKRHIPQTLV
AASGSLQQLRGSLDQLALLYGVSSPFVAHIAAAEFTASEGLVSNYDGALRLAEDLGLGLV
ASSSTYEAQHMSIFSTLLASLIPTLHVYDGIRVARETLRVVDALSETGVADLYRKLAAEV
GKLNKRLDTAGKVIELLKLFNDELGTVYEPFEYHGHETPDVVLVTFGSVESQTAKQVLSK
ISADGAKAGVINVRIYRPFIEEEFLKVIPASARTIAVLGQVQTEVAVADEAVQSALYADV
LTAVAFSDKFAQEPEILDIKYTPSQAITPQGIVDTLHKIFGNGPESKRLPSLVEAQQYTF
WDVDDSVTVNSASAIGSVLSKESRANVYVHNEYDNLTQGGITRADVRASKKALEAPYAVE
EADVVVVGDERLLKAVDVTKGLAADGDIIVKLTNFKEDEVEKRLPAWFRKAVHEKAADLH
ILDASYSPAFEKDPVFTKLLLEIAFLKTARPGLSLEDLSQLAVVESQPPTLEECIDAVGQ
CLRKIEVPSSWAEVDADYSDPQLPSVIQTNSFVPFQKEEPEEVLELRDWQDAAKGLVFKE
AYGTETKLRPDLSVKTSTIRVKENRRLTPLEYDRNIFHIEFDLGDSGLTYKIGEALGIHA
ENDPEQISAFIDFYGLNPDELVQVPARDDPSAFEVRTVFQALKQNVDILGKPPKRFYEAL
AEFATDETEKKKLEQLGGQEGAEEFKHRSEVDTVTYVDILEEFCSAHPSFHDLIKIVSPL
KRREYSIASAQAVTPTSVALMIVVVDWVDTKGRTRYGQASHYLSKLAPGTPITASVKPSV
MKLPANDSAPLIMAGLGTGLAPFRAFVQYRAMQKAQGKDIGSILLYLGSRHQREEYLYGE
EWEAYLAAGVVTLVGAAFSRDQPHKIYIQDRMRQTLSDIVQAYIKDEGSFYLCGPTWPVP
DVTAVLQEAIATDAKNSGAKKVDPKKEIEKLKEQGRYVLEVY
Download sequence
Identical sequences A0A086SWB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]