SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086T370 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086T370
Domain Number 1 Region: 364-565
Classification Level Classification E-value
Superfamily MIR domain 2.49e-58
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086T370
Sequence length 979
Comment (tr|A0A086T370|A0A086T370_ACRC1) Dolichyl-phosphate-mannose--protein mannosyltransferase-like protein {ECO:0000313|EMBL:KFH43802.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_054470 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MGKSNSTRGRSPLPPTEKQFATSPTLTVPGDAGKTRSKSRSKSRSKSRSRKNKAVAAGAA
GKDTSYKSDGVDDHDVFLLPLSDYGVMIGLTILALVVRVYKIYQPSSVVFDEVHFGGFAS
KYIKGKFFMDVHPPLAKMLIALTGWLAGFDGSFDFKEIGKDYVEPNVPYVAMRLFPALCG
VAVAPFMYLTLKSVGCRSMTALMGTGLIIFENGLLTQARLILLDSPLVAATAFTALAFNA
FTNQHEQGPEKAFGISWWFWLINTGIGLGITFSIKWVGLFTIAWVGILTVLQLWILLGDT
KNVSIRLWFKHFTARVFALIVIPLTFYMAMFAIHFVCLVNPGDGDGFMSSEFQATLNTKK
MKDVPADVVMGSRVTIRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKDENNVWLLENQT
QPLGVDGEPINGTNAWDLLPEPQYIKDGAVLRLYHTNTHRRLHSHDVRPPVTEADWQNEV
SAYGYEGFEGDANDYFRVEIMGKKSRGAVAKERLRTIETKFRLVHVMTGCVLFSHKVKLP
EWASEQQEVTCARGGSLPNSLWYVEWNESPHLGPSAEKVNYRKLGFFDKFFELQRVMWKT
NAGLTDSHTWDSRPQSWPILRRGINFWGRAHTQIYLIGNPVIWWASSAAVVTWVVFKAIA
VLRWQRNCSDYSNVTFKRFDYEVGTSVLGWALHYFPFYLMKRQLFLHHYFPALYFAIIAF
CQVFDYATARLPGVRGRESSFINKIGAVAFLTLSAAVFVLYSPLAYGNPWTKAECNRVKL
FPTWDFDCKTFYDSYDKYTLHTVQAGTAATPSGQAVDAQAPGHEGGGAQEAASVSDAPQG
EPRIIKQEKVEYRDSDGNLLNEEQVKALEGKVEFETKYETRTRVVDEFGNEIPNPEELRP
AGAAGAAGVAPPHPDVEGVDKETVGSGSVGDAPAAGVDDDAARAPPQDAAASRDGEKEAE
INQPKPASEGKEATVHEEL
Download sequence
Identical sequences A0A086T370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]