SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086TCB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086TCB9
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000248
Family Preprotein translocase SecE subunit 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086TCB9
Sequence length 63
Comment (tr|A0A086TCB9|A0A086TCB9_ACRC1) Protein transport protein Sec61 subunit gamma-like protein {ECO:0000313|EMBL:KFH47001.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_021100 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MADQIQELLEAPSEFAKNGIQFMRRCTKPDKAEYLRLCQAVGVGLVIMGAVGYILPLTRV
LVA
Download sequence
Identical sequences A0A086TCB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]