SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086TCC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086TCC5
Domain Number 1 Region: 52-165
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.31e-20
Family Transducin (alpha subunit), insertion domain 0.00092
Further Details:      
 
Domain Number 2 Region: 28-52,168-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000347
Family G proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086TCC5
Sequence length 306
Comment (tr|A0A086TCC5|A0A086TCC5_ACRC1) Guanine nucleotide-binding protein subunit alpha-like protein {ECO:0000313|EMBL:KFH47007.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_021220 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MGGVLSSVKRVRGGRAPRDRQSYPTQWLLVGPPGAGKTTFLRQMKIIHHGGYTIGERASL
KKDIFTTMIQAMRDTLDSMVPLGLALDDPGLETHARVIAEHSLELESDSLPPHVGRAIDA
LWRNDTVQECHMRPDVYSNSAVYYFDNINRLAAEDYVPSQHDIMLLDTKATDLSDITYFY
GGQLHRFFELDAEQVRQGLPDGPFSALIAFVDLSTYCQPLTSRHDNHGPFDAMVELLGSM
STATTSWPIHTPLIVMFNKMDVFIQKFTLGAFRHHFPDYDGPDEYERAIDHLLGLFNETI
DPLWMC
Download sequence
Identical sequences A0A086TCC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]