SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086TD61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086TD61
Domain Number 1 Region: 332-519
Classification Level Classification E-value
Superfamily MIR domain 2.35e-50
Family MIR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086TD61
Sequence length 767
Comment (tr|A0A086TD61|A0A086TD61_ACRC1) Dolichyl-phosphate-mannose--protein mannosyltransferase-like protein {ECO:0000313|EMBL:KFH47293.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_018720 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MARSSTPQGSLRQRNVGSKKGESTVSSPEPDISKLAKATQKKTKVDNERDYKIALAIITA
LAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFGKLLFAFMGWLVGYDGH
FHFENIGDSYIDNKVPYVAFRALPAILGALTVSVTYLIMWESGYSLPACIVAASLVLLDN
AHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHQPFSKKWWKWLILTGFALSCDISVKY
VGLFAFVTIGSAVLIDLWDLLDVNRAKGALSIPEFGKHFAARAFGLIIMPFIFYLFWFQV
HFTILNRSGPGDDFMTPEFQETLSDNVMLANSLDIQYYDTLTIRHKETKAYLHSHEDHYP
LRYDDGRVSSQGQQVTGYPYNDTNNHWQILPADGNQETGRNILNHDLVRLRHLATDKILL
SHDVASPYYPTNQEFTAVSAEDALGKRANDTLFEIRIEHGKKKHNFKTVASHFKLIHNPS
KVAMWTHTKPLPDWGYKQQEINGNKQVAASSNVWVAEDIPSLAEGDPRRNKPERKVKSMA
FLRKWFELQKAMFYHNSRLTSSHPYSSHPYQWPFLLRGVSFWTQADTRQQIYFLGNPFGW
WLASSLLAVYAGIVMADQVSLRRGIDALDHRTRSRLYNSTGFFFLAWATHYFPFYLMGRQ
LFLHHYLPAHVASCLVTGALIEFIFNPDTADEESIYGPRGGPNKHVSARERFAGRSMKGA
WIACLTVISIAIAGWYFFLPLTYGYPGLSVEQVKMRKLLGYDLHFAK
Download sequence
Identical sequences A0A086TD61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]