SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086W9T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086W9T0
Domain Number 1 Region: 158-345
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-70
Family Methylesterase CheB, C-terminal domain 0.00000037
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily CheY-like 9.68e-29
Family CheY-related 0.00000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086W9T0
Sequence length 353
Comment (tr|A0A086W9T0|A0A086W9T0_9BURK) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1549812 OS=Massilia sp. BSC265. GN=JN27_12575 OC=Oxalobacteraceae; Massilia.
Sequence
MTIKVLIVDDSALIRSVMSEIVNSQPDMEVVATAPDPLVARELIKRHNPDVLTLDVEMPK
MDGLDFLEKLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKISIQTGMREYTE
LIADKIRATARARIKRMVPGSVPAPQLSALRSPLISSEKLIIIGASTGGTEAIREFLMQM
PSDCPGILIAQHMPEGFTSSFAKRLDSLCKINVTESQGNERVLPGHAYIAPGHSHLLLSR
SGANYMTKIEQSPPVNRHRPSVDVLFRSAAQAAGKNAVGVILTGMGKDGAAGMLDMRHAG
AHNFAQDEASCVVFGMPREAIALGAAHEVGSLQALPRMVLDHLASQGGRALRV
Download sequence
Identical sequences A0A086W9T0
WP_036248814.1.28810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]