SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086WV90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086WV90
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily YcfC-like 1.96e-80
Family YcfC-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086WV90
Sequence length 205
Comment (tr|A0A086WV90|A0A086WV90_9VIBR) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome OX=1526762 OS=Vibrio sp. B183. GN=IX95_00350 OC=Vibrionaceae; Vibrio.
Sequence
MANALYDRTIAFAGICQAVALVQQVAKNGHCDSDAFETSLKAILNTNPNNTVGVYGRESD
LKLGLECLVKGIDSTPSGSEVTRYIISLMALERKLSGRNDAMSQLADRIQMIERQLDHFE
LLDDQMISNLASVYLDVISPIGPRIQVTGTPSVLQQTGNQHKVRALLLSGIRSAVLWRQV
GGKRRHLIFGRKKMVEQAQILLARM
Download sequence
Identical sequences A0A086WV90 A0A097QJ01
WP_006962785.1.101448 WP_006962785.1.10351 WP_006962785.1.32172 WP_006962785.1.55911 WP_006962785.1.56963 WP_006962785.1.62724 WP_006962785.1.6449 WP_006962785.1.64705 WP_006962785.1.78027 WP_006962785.1.89582 WP_006962785.1.95475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]