SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086Y869 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086Y869
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-23
Family Anti-sigma factor antagonist SpoIIaa 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086Y869
Sequence length 113
Comment (tr|A0A086Y869|A0A086Y869_9RHOB) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=195105 OS=Haematobacter massiliensis. GN=CN97_13015 OC=Rhodobacteraceae; Haematobacter.
Sequence
MQLSARLTDGLLLIRVEESRIDAASAIAFKERMRHLTAEPAPRVILDMAEVAFLDSSGLG
ALVAVMKLLQPERRLELAGVTPMVAKVLTLTRMDRIFRILPPLDEAGPLPLAS
Download sequence
Identical sequences A0A086Y869
WP_035709026.1.45337 WP_035709026.1.66515 WP_035709026.1.71246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]