SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A086YLM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086YLM0
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086YLM0
Sequence length 186
Comment (tr|A0A086YLM0|A0A086YLM0_9FIRM) 2-oxoacid:ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KFD42248.1} KW=Complete proteome; Reference proteome OX=1487582 OS=Peptococcaceae bacterium SCADC1_2_3. GN=DK28_0211080 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae.
Sequence
MFESVLLAGFGGQGILSAGQLLAYAGTLAGKHVTWVPSYGAEMRGGTANCGVTISSRPIS
SPIVSEPEALMAMNRPSLEKFEQSVVSNGLIVVNSSLVNCKIARKDVQVMYISANKLAEE
LGNNKVAVNIVLGALIFLTQIVSLELAIESLGKVFPPRHQKLIALNQRALKAGAQFFDHL
AKEKAG
Download sequence
Identical sequences A0A086YLM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]