SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086ZEE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086ZEE4
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.27e-46
Family Ribosomal protein S13 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086ZEE4
Sequence length 125
Comment (tr|A0A086ZEE4|A0A086ZEE4_9BIFI) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome; Reference proteome OX=1437606 OS=Bifidobacterium bohemicum DSM 22767. GN=BBOH_1625 OC=Bifidobacterium.
Sequence
MARLAGVDIPNEKRIEVALTYIFGVGRTRAKETLAATGVNPDTRVKDLSDEQLITLRDYL
EGNYKIEGDLRREIDADIRRKVQINCYQGRRHRQGLPVRGQRTKTNARTRKGPKRTVAGK
KKATK
Download sequence
Identical sequences A0A086ZEE4
WP_033520846.1.25506 WP_033520846.1.2602 WP_033520846.1.83771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]