SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087GAD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087GAD1
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 2.36e-24
Family Steroid-binding domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087GAD1
Sequence length 131
Comment (tr|A0A087GAD1|A0A087GAD1_ARAAL) Uncharacterized protein {ECO:0000313|EMBL:KFK26833.1} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA8G299800 OC=Arabis.
Sequence
MVEEEKPPIPQLVQVGEISEEELKQYDGSDPNKPILMAIKLQIYDVTPSRMLYEPGGPYD
LFAAKDASRALAMMSFEEKDLTWDISGLGSSELQSLQGWELNFMDKYAKVGTLKATASSQ
SETTPVSCNHP
Download sequence
Identical sequences A0A087GAD1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]