SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087GZ08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087GZ08
Domain Number 1 Region: 84-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.75e-28
Family Skp1 dimerisation domain-like 0.0000458
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily POZ domain 9.1e-22
Family BTB/POZ domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087GZ08
Sequence length 162
Comment (tr|A0A087GZ08|A0A087GZ08_ARAAL) Uncharacterized protein {ECO:0000313|EMBL:KFK35110.1} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA5G237300 OC=Arabis.
Sequence
MSSKKIVLKSSDGESFEVDEAVALQSQTIKHMIEDDCAGDGIPLPNVTGKILAKVVEYCK
KHVEVEAEGGDKDVYGSKEEDEALKTWDTEFAKTDDQATLFEIILAANYLNIGGLLDLMC
KTVADMMRGKTPEEMRTLFNIKNDYTPEEEAEVRRENAWAFE
Download sequence
Identical sequences A0A087GZ08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]