SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087M5J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087M5J0
Domain Number 1 Region: 175-363
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-70
Family Methylesterase CheB, C-terminal domain 0.000000705
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily CheY-like 6.97e-30
Family CheY-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087M5J0
Sequence length 372
Comment (tr|A0A087M5J0|A0A087M5J0_9RHIZ) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=46914 OS=Devosia riboflavina. GN=JP75_04020 OC=Hyphomicrobiaceae; Devosia.
Sequence
MSKIRVLIVDDSASVRTTLSEIISADPDLEVMATAADPYVAVEKIRHEVPDVIFLDVEMP
RMDGLTFLKKIMSQRPIPVVICSGLAQAGSDTLMQCMEAGAVDVVTKPRVDTAQFLQESR
MRICDAAKAAAHAKLKGLKKAAPELKVEAKLTADAVIPPISDTRRDSLIARMPVTEPIVA
IGASTGGTEALREVLEELPASSPAILIVQHMPEKFTGAFARRLDSTCAIEVKEAEDGDLV
IAGRALIAPGNVHMQLVRNGSRYTVKIVEGPHVSRHRPSVDVLFRSTAQAAGRNALGMLL
TGMGDDGARGLLEMRQMGSPTVAQDEESSVVFGMPKEAIQRGAAGRVLPLSRMATEIVNF
GRNAAKPAGGMA
Download sequence
Identical sequences A0A087M5J0
WP_035079555.1.62350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]