SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087N5K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087N5K6
Domain Number 1 Region: 197-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.35e-71
Family PFOR Pyr module 0.02
Further Details:      
 
Domain Number 2 Region: 4-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.1e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.004
Further Details:      
 
Domain Number 3 Region: 470-577
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.27e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087N5K6
Sequence length 579
Comment (tr|A0A087N5K6|A0A087N5K6_9BACI) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KFL44409.1} KW=Complete proteome; Reference proteome OX=1473546 OS=Lysinibacillus sp. BF-4. GN=CH76_00940 OC=Lysinibacillus.
Sequence
MLHQLSWKVGGQQGEGIESTGEIFSMAMNRLGYFLYGYRHFSSRIKGGHTNNKITVRATE
VRAITDDLDILVAFDQETIDVNYHELTEKGIILADAKFNPAQPEDCKAPLFAVPFTEIAT
ELGTSLMKNMVAIGATASLLNLEDEVFQSVVNEIFGRKGEVVVQKNMEAIAKGHEVMNEL
LGERVGDWEVVKADGKHRMFMIGNDAVALGALAAGVRFMAAYPITPASEIMEYLIDKLPE
VGGAVIQTEDEIAAATMAIGANYGGVRSFTASAGPGLSLMMEAIGLSGMTEQPLIIVDTQ
RGGPSTGLPTKQEQSDLMAMLYGTHGEIPKVVIAPSTAEEAFYDTIQAFNIAEELQLPVI
ILTDLQLALGKQTVEPFDYSKVEIRRGKLVDSVEAPEIDKAYFKRYETTTDGVSPRVIPG
VEHGIHHVTGVEHDETGKPSEAPSNRAAQMEKRFRKLDAINFKEPIYARTEHEDADVLVV
GFNSTRGAIDEALERLTNQGMKVNHAQVRLIHPFPVEEMQALMAKAKKVVVVENNFTGQL
ANIMKMNVGGHNKITTINKYDGTPFLPGEIETKVKELLK
Download sequence
Identical sequences A0A087N5K6
WP_036141579.1.81564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]