SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087QCT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087QCT6
Domain Number 1 Region: 197-244
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0000000262
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087QCT6
Sequence length 244
Comment (tr|A0A087QCT6|A0A087QCT6_LACGS) Uncharacterized protein {ECO:0000313|EMBL:KFL97439.1} KW=Complete proteome OX=575604 OS=Lactobacillus gasseri SV-16A-US. GN=HMPREF5175_00278 OC=Lactobacillus.
Sequence
MRIFMNGESKMKNKVVKIIMWILFWFYLIPYYLVKKFLFKKTSHPILWANCVTLGLFFVL
GLATSPNTHTTSHQSAQKTTLTKSKKVAHKTATETITKKVGTDELNKEKARAKVLTQEEK
NKQAEYDKLKKQLDNYQEKEEKQKQEAEQERKAAEVQAQKEAAAKKKEIEEAQKKAQQNQ
ETNNDSSSSQGDLYTANQGTIVGNRNSMIYHVPGQAGYHMHSANAVYFNSEQDAINAGYR
KAKR
Download sequence
Identical sequences A0A087QCT6
WP_003647452.1.12732 WP_003647452.1.258 WP_003647452.1.27557 WP_003647452.1.30511 WP_003647452.1.42744 WP_003647452.1.53875 WP_003647452.1.60404 WP_003647452.1.80685 WP_003647452.1.85201 324831.LGAS_0843 gi|116629498|ref|YP_814670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]