SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087REL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087REL0
Domain Number 1 Region: 527-557,597-675
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.84e-17
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087REL0
Sequence length 675
Comment (tr|A0A087REL0|A0A087REL0_APTFO) Solute carrier family 26 member 2 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_11879 OC=Aptenodytes.
Sequence
HHRMFLEPQEKKRSMKALVVKQAKKTCSCTPAKVKDYVFSFFPVLQWLPKYKLREYLLGD
IMSGVIVGVLLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFIFGTSRHISVGIFGVICLM
VGQVVDREIQRAGYDLEPAALSVLTDTAAYVNTTILPVNQTSQKLLCDKSCYAITVGATM
TFIAGVYQVAMGFFQVGFVSVYLSDSLLSGFVTGASFTIVTSQAKYLLGLDIPRSSGIGS
LIATWINIFRNIHKTNICDLITSFLCFLVLIPTKELNEHFKSRLKAPIPVELVVIVAATL
ASHFGKLRETYGSSVAGHIPTGFLPPRPPDWNLIPNVALDAIPIAIIGFAITVSLSEMFA
KKHGYSVKANQEMYAIGFCNIIPSFFHCFITSAALAKTLVKESTGCRTQMSGMVTSLVIL
LVLLVIAPLFYSLQKCVLAVITIVNLRGALRKFKDLPKMWHLSRVDTVIWLVTMAASALI
STEIGLLVGVCFSMLCVIFRTQRPEAPLLGWVAESETYESLSAYKNLQTKPGIVVFRFEA
PLYYINKECFKSTLYKQTGVNPVWVKAAKKKAAKRMLREKEVDSGGNQTSISMDFVSESL
GFHTIVIDCCAVQFLDTAGIRTLKEVCKDYREIGVQVLLAQCNPSVRSSLIRGEFFKEGE
DHLLFHSVHQAVDFA
Download sequence
Identical sequences A0A087REL0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]