SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RGG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RGG1
Domain Number 1 Region: 24-83
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 4.19e-18
Family Interleukin 8-like chemokines 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087RGG1
Sequence length 86
Comment (tr|A0A087RGG1|A0A087RGG1_APTFO) C-C motif chemokine {ECO:0000256|RuleBase:RU361150} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_04125 OC=Aptenodytes.
Sequence
SKSLVLVSLLGLLALLLCGTSEAQSNQDCCLSYTKVRLPRWALKGYTEQLSSEVCDIHAI
IFHTYGGLNACVNPKEGWVKKHLLFL
Download sequence
Identical sequences A0A087RGG1 A0A093NUI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]