SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RRK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RRK2
Domain Number 1 Region: 18-163
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 1.31e-51
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0000628
Further Details:      
 
Domain Number 2 Region: 175-382
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.6e-51
Family Class I glutamine amidotransferases (GAT) 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087RRK2
Sequence length 384
Comment (tr|A0A087RRK2|A0A087RRK2_9ARCH) Carbamoyl-phosphate synthetase glutamine chain {ECO:0000256|HAMAP-Rule:MF_01209} KW=Complete proteome OX=1502291 OS=Marine Group I thaumarchaeote SCGC AAA799-D11. GN=AAA799D11_00905 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
MLRVTITTKKSIHANKHGKLIFDDGTVFDGQGFGYSTTVFGEIVFNTGMVGYTEALTDPS
YNGQILTLTYPLVGNYGVPDPEIKDEDGISKFFESNVMQIRGLVVHELSLTASHWNLKMT
LDEWMYNEKVPGISGIDTRAVTKKLRSSGVMMAALVVSEEPIDVEKIKKDLAEATDYNSE
KFMDSVSTKEEKTYGHDSESVVVIDTGAKNAIVRNVRELGYNAIVVPWNTPYEKVMAHNP
KGVVLSSGPGDPQNCPATVDTAKKLIENNVPTLGICLGAQIIGLAGNTETYKLKYGHRGQ
NKPCINLETNQVYVTSQNHGYGIKPESLEKSDFKLWFTNADDKTVEGIKHKTQNCIAVQF
HPEAAPGPFDCKYVFEELKKLMEK
Download sequence
Identical sequences A0A081RPC7 A0A081S6M7 A0A087RRK2 A0A087RWI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]