SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RS59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RS59
Domain Number 1 Region: 54-224
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.75e-59
Family Substrate-binding domain of HMG-CoA reductase 0.00000293
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.00000000000000275
Family NAD-binding domain of HMG-CoA reductase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087RS59
Sequence length 255
Comment (tr|A0A087RS59|A0A087RS59_9ARCH) 3-hydroxy-3-methylglutaryl coenzyme A reductase {ECO:0000256|RuleBase:RU361219} KW=Complete proteome OX=1503183 OS=Marine Group I thaumarchaeote SCGC RSA3. GN=SCCGRSA3_02386 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
MLIVELLIDVGDAMGANVTNTMCEGIAPLIEKLTGGKTLLRILSNYSTRRMVKATAIFDK
ESVGGEEVVDNMIHAYQFAKHDVYRAVTHNKGIMNGIIAVANATGQDSRAIEAAANAYAS
RSGQYRSLSEWTKDLDGNLVGTLEIPLSVGIVGGIINVHPVAKICTKILDAESAKEMACI
ITATGLAQNFSAMRALATDGIQKGHMRLHARNLASAAGASTEEKIRKLVQGNTVFVIGSG
PSLSYAIPKLKNLKK
Download sequence
Identical sequences A0A087RS59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]