SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087S3B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087S3B8
Domain Number 1 Region: 239-373
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.34e-36
Family PFOR Pyr module 0.042
Further Details:      
 
Domain Number 2 Region: 5-143,170-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.28e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087S3B8
Sequence length 378
Comment (tr|A0A087S3B8|A0A087S3B8_9ARCH) 2-oxoglutarate synthase subunit KorA protein {ECO:0000313|EMBL:KFM20222.1} OX=1502290 OS=Marine Group I thaumarchaeote SCGC AAA799-D07. GN=AAA799D07_00503 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Marine Group I.
Sequence
MVFDYSWLIGGPQGSGVDTAANIFSRVGAKLGYHVFGKREYHSNIKGLHSYFVVRLSDSK
VRSNVNGANMMVAFDAETMIRHGLSISKNGAIIYDSSIVNTSIDEIPTIEVDHRVRLNEF
FKTKNMEPKVSSIIELAKESGVNVYPISFRDALSNIADELKRPELSRMTRMFNVLGVSFS
LGILKSPITPLLESIEEIFSTKPAIIDLNKKAANFAYNYASAKFSGFNSSLNETDKEPNV
MLVQGHQGSALGKMVCGCRFQSYYPITPASDESEVLETHEILQVKEDRPGSTIIVQTEDE
ISAIGMAVGASLTGTRSATSTSGPGFSLMAETLGWAGINEVPVVISLFQRSGPSTGLPTR
QGQDDLLFAINSLCIRRC
Download sequence
Identical sequences A0A087S3B8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]