SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087SAN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087SAN1
Domain Number 1 Region: 8-128
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087SAN1
Sequence length 143
Comment (tr|A0A087SAN1|A0A087SAN1_AUXPR) Sulfate transporter 1.1 {ECO:0000313|EMBL:KFM22785.1} KW=Complete proteome; Reference proteome OX=3075 OS=protothecoides). GN=F751_2976 OC=Chlorellaceae; Auxenochlorella.
Sequence
MHVKLFPDTQQTPGVLVMRVDAPFFFANVESIRDGIVRRVEEAQATPEAESGAAPVRYVV
LDMGAVTDVDATSIHWLTEFVYDLKSDLGVQLVLSNLTRPVLRAIKNGNVHRRLGPDHIF
VDTNDAVVTLSTGLKQGRVDKAL
Download sequence
Identical sequences A0A087SAN1
XP_011395650.1.37273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]