SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087UBG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087UBG4
Domain Number 1 Region: 19-64
Classification Level Classification E-value
Superfamily Elafin-like 0.000000575
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087UBG4
Sequence length 68
Comment (tr|A0A087UBG4|A0A087UBG4_9ARAC) U20-lycotoxin-Ls1d {ECO:0000313|EMBL:KFM74703.1} KW=Complete proteome; Reference proteome OX=407821 OS=Stegodyphus mimosarum. GN=X975_17462 OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
MELKAQVIILVVVCIAAAASERYCPEVKGECSLSYRINDCCSQDDCPSYAMCCKGRCGYV
CKNPSDSP
Download sequence
Identical sequences A0A087UBG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]